• Gene id: 10957

Gene Summary

• Gene Symbol: PNRC1   Gene   UCSC   Ensembl
• Aliases: B4-2, PNAS-145, PROL2, PRR2
• Gene name: proline rich nuclear receptor coactivator 1
• Alternate names: proline-rich nuclear receptor coactivator 1, proline rich 2 protein, proline-rich polypeptide 2, proline-rich protein 2, proline-rich protein with nuclear targeting signal, protein B4-2,
• Gene location: 6q15 (89080748: 89085159)     Exons: 3     NC_000006.12
• OMIM: 606714

Protein Summary

• Protein general information: Q12796  
  • Name: Proline rich nuclear receptor coactivator 1 (Proline rich protein 2) (Protein B4 2)
  • Length: 327  
  • Mass: 35225
  • Tissue specificity: Expressed in liver, lung, fat and NK/T cells. {ECO
• Sequence:

  MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTPQPRAP
  AALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPS
  PAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKI
  TSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHW
  MGSTVENSNQNRELMAVHLKTLLKVQT

• Structural information:
  • Interpro: IPR026780  
  • STRING: ENSP00000336931
• Other Databases: GeneCards:  PNRC1  Malacards:  PNRC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881