• Gene id: 10956

Gene Summary

• Gene Symbol: OS9   Gene   UCSC   Ensembl
• Aliases: ERLEC2, OS-9
• Gene name: OS9 endoplasmic reticulum lectin
• Alternate names: protein OS-9, amplified in osteosarcoma 9, endoplasmic reticulum lectin 2, erlectin 2, osteosarcoma amplified 9, endoplasmic reticulum associated protein, osteosarcoma amplified 9, endoplasmic reticulum lectin,
• Gene location: 12q13.3-q14.1 (57693954: 57721556)     Exons: 15     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein that is highly expressed in osteosarcomas. This protein binds to the hypoxia-inducible factor 1 (HIF-1), a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. Alternate t
• OMIM: 606615

Protein Summary

• Protein general information: Q13438  
  • Name: Protein OS 9 (Amplified in osteosarcoma 9)
  • Length: 667  
  • Mass: 75562
  • Tissue specificity: Ubiquitously expressed. Found as well in all tumor cell lines analyzed, amplified in sarcomas. Highly expressed in osteosarcoma SJSA-1 and rhabdomyosarcoma Rh30 cell lines. Isoform 2 is the major isoform detected in all cell types exam
• Sequence:

  MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDVVIVSSKYKQRYECRL
  PAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGEVLYLGYYQS
  AFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTP
  RLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGAS
  PTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGG
  TKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGEFEKELEGILLPSDRD
  RLRSEVKAGMERELENIIQETEKELDPDGLKKESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKK
  PPPSPQPTEEDPEHRVRVRVTKLRLGGPNQDLTVLEMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWA
  EGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF

• Structural information:
  • Protein Domains: (108..17-)
    (/note="PRKCSH"-)
  • Interpro: IPR009011  IPR012913  
  • PDB: 3AIH
  • PDBsum: 3AIH
  • DIP: 37493
  • STRING: ENSP00000318165
• Other Databases: GeneCards:  OS9  Malacards:  OS9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904153	negative regulation of retrograde protein transport, ER to cytosol	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030970	retrograde protein transport, ER to cytosol	IBA	biological process
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0006621	protein retention in ER lumen	IDA	biological process
GO:0005515	protein binding	IDA	molecular function
GO:0005515	protein binding	IDA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0000836	Hrd1p ubiquitin ligase complex	NAS	cellular component
GO:0000836	Hrd1p ubiquitin ligase complex	NAS	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:1904380	endoplasmic reticulum mannose trimming	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006605	protein targeting	IEA	biological process
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0002020	protease binding	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0044322	endoplasmic reticulum quality control compartment	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904153	negative regulation of retrograde protein transport, ER to cytosol	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030970	retrograde protein transport, ER to cytosol	IBA	biological process
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0006621	protein retention in ER lumen	IDA	biological process
GO:0005515	protein binding	IDA	molecular function
GO:0005515	protein binding	IDA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0000836	Hrd1p ubiquitin ligase complex	NAS	cellular component
GO:0000836	Hrd1p ubiquitin ligase complex	NAS	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:1904380	endoplasmic reticulum mannose trimming	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006605	protein targeting	IEA	biological process
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0002020	protease binding	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0044322	endoplasmic reticulum quality control compartment	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881