• Gene id: 10955

Gene Summary

• Gene Symbol: SERINC3   Gene   UCSC   Ensembl
• Aliases: AIGP1, DIFF33, SBBI99, TDE, TDE1, TMS-1
• Gene name: serine incorporator 3
• Alternate names: serine incorporator 3, tumor differentially expressed protein 1,
• Gene location: 20q13.12 (44522115: 44496220)     Exons: 11     NC_000020.11
• OMIM: 607165

Protein Summary

• Protein general information: Q13530  
  • Name: Serine incorporator 3 (Tumor differentially expressed protein 1)
  • Length: 473  
  • Mass: 52580
  • Tissue specificity: Ubiquitous. Expression levels were increased fourfold to tenfold in lung tumor tissues compared with normal pulmonary tissues. {ECO
• Sequence:

  MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGG
  FKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFY
  IPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLY
  TYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLM
  SFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVILG
  DTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTSKWPAVWVKISSS
  WVCLLLYVWTLVAPLVLTSRDFS

• Structural information:
  • Interpro: IPR029557  IPR005016  
  • STRING: ENSP00000340243
• Other Databases: GeneCards:  SERINC3  Malacards:  SERINC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0045087	innate immune response	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0009597	detection of virus	IDA	biological process
GO:0009597	detection of virus	IDA	biological process
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0006658	phosphatidylserine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006564	L-serine biosynthetic process	TAS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1902237	positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)