• Gene id: 10953

Gene Summary

• Gene Symbol: TOMM34   Gene   UCSC   Ensembl
• Aliases: HTOM34P, TOM34, URCC3
• Gene name: translocase of outer mitochondrial membrane 34
• Alternate names: mitochondrial import receptor subunit TOM34, hTom34, outer mitochondrial membrane translocase (34kD), translocase of outer membrane 34 kDa subunit,
• Gene location: 20q13.12 (11529133: 11505915)     Exons: 9     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein,
• OMIM: 616049

Protein Summary

• Protein general information: Q15785  
  • Name: Mitochondrial import receptor subunit TOM34 (hTom34) (Translocase of outer membrane 34 kDa subunit)
  • Length: 309  
  • Mass: 34559
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCT
  SALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLV
  PVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNL
  ESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKL
  RQEVKQNLH

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR001440  IPR019734  
  • Prosite: PS50005 PS50293
  • STRING: ENSP00000361900
• Other Databases: GeneCards:  TOMM34  Malacards:  TOMM34

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006626	protein targeting to mitochondrion	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0031072	heat shock protein binding	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0006626	protein targeting to mitochondrion	IMP	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray