• Gene id: 10952

Gene Summary

• Gene Symbol: SEC61B   Gene   UCSC   Ensembl
• Gene name: SEC61 translocon subunit beta
• Alternate names: protein transport protein Sec61 subunit beta, SEC61 translocon beta subunit, Sec61 beta subunit, Sec61 complex, beta subunit, protein translocation complex beta, protein transport protein SEC61 beta subunit,
• Gene location: 9q22.33 (99222281: 99230614)     Exons: 2     NC_000009.12
• Gene summary(Entrez): The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER mem
• OMIM: 609214

Protein Summary

• Protein general information: P60468  
  • Name: Protein transport protein Sec61 subunit beta
  • Length: 96  
  • Mass: 9974
• Sequence:

  MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLV
  MSLLFIASVFMLHIWGKYTRS

• Structural information:
  • Interpro: IPR030671  IPR016482  
  • DIP: 40997
  • STRING: ENSP00000223641
• Other Databases: GeneCards:  SEC61B  Malacards:  SEC61B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0031205	endoplasmic reticulum Sec complex	IBA	cellular component
GO:0031204	posttranslational protein targeting to membrane, translocation	IBA	biological process
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005784	Sec61 translocon complex	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IDA	biological process
GO:0031205	endoplasmic reticulum Sec complex	ISS	cellular component
GO:0030970	retrograde protein transport, ER to cytosol	IMP	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0048408	epidermal growth factor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa04145	Phagosome
hsa05110	Vibrio cholerae infection
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881