• Gene id: 10949

Gene Summary

• Gene Symbol: HNRNPA0   Gene   UCSC   Ensembl
• Aliases: HNRPA0
• Gene name: heterogeneous nuclear ribonucleoprotein A0
• Alternate names: heterogeneous nuclear ribonucleoprotein A0, hnRNA binding protein, hnRNP A0,
• Gene location: 5q31.2 (137754362: 137745650)     Exons: 1     NC_000005.10
• Gene summary(Entrez): This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs i
• OMIM: 609409

Protein Summary

• Protein general information: Q13151  
  • Name: Heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)
  • Length: 305  
  • Mass: 30841
• Sequence:

  MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGN
  TVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHD
  AADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGG
  GGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGY
  GGSSF

• Structural information:
  • Protein Domains: (7..8-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (98..17-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034801  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12326
  • STRING: ENSP00000316042
• Other Databases: GeneCards:  HNRNPA0  Malacards:  HNRNPA0

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0006397	mRNA processing	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0070935	3'-UTR-mediated mRNA stabilization	TAS	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	ISS	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0006954	inflammatory response	ISS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006397	mRNA processing	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0016070	RNA metabolic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	IEA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Gastric adenocarcinoma	PMID:23007704
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)