• Gene id: 10945

Gene Summary

• Gene Symbol: KDELR1   Gene   UCSC   Ensembl
• Aliases: ERD2, ERD2.1, HDEL, PM23
• Gene name: KDEL endoplasmic reticulum protein retention receptor 1
• Alternate names: ER lumen protein-retaining receptor 1, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 1, KDEL receptor 1, putative MAPK-activating protein PM23,
• Gene location: 19q13.33 (48391550: 48382574)     Exons: 5     NC_000019.10
• Gene summary(Entrez): Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-ter
• OMIM: 609949

Protein Summary

• Protein general information: P24390  
  • Name: ER lumen protein retaining receptor 1 (KDEL endoplasmic reticulum protein retention receptor 1) (KDEL receptor 1) (Putative MAPK activating protein PM23)
  • Length: 212  
  • Mass: 24542
• Sequence:

  MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYNTCMKVVYIACSFTTV
  WLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILWTFSIYLESVAILPQLFMVSKTGEAETITSH
  YLFALGVYRTLYLFNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA

• Structural information:
  • Interpro: IPR000133  
  • Prosite: PS00951 PS00952
  • DIP: 48668
  • STRING: ENSP00000329471
• Other Databases: GeneCards:  KDELR1  Malacards:  KDELR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046923	ER retention sequence binding	IBA	molecular function
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006621	protein retention in ER lumen	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005046	KDEL sequence binding	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005046	KDEL sequence binding	IDA	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IDA	biological process
GO:0030663	COPI-coated vesicle membrane	IDA	colocalizes with
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IDA	biological process
GO:0046923	ER retention sequence binding	IEA	molecular function
GO:0006621	protein retention in ER lumen	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002369	T cell cytokine production	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0030217	T cell differentiation	IEA	biological process
GO:0070231	T cell apoptotic process	IEA	biological process
GO:0030663	COPI-coated vesicle membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05110	Vibrio cholerae infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881