• Gene id: 10935

Gene Summary

• Gene Symbol: PRDX3   Gene   UCSC   Ensembl
• Aliases: AOP-1, AOP1, HBC189, MER5, PRO1748, SP-22, prx-III
• Gene name: peroxiredoxin 3
• Alternate names: thioredoxin-dependent peroxide reductase, mitochondrial, antioxidant protein 1, epididymis secretory sperm binding protein, peroxiredoxin III, protein MER5 homolog,
• Gene location: 10q26.11 (119178811: 119167719)     Exons: 7     NC_000010.11
• Gene summary(Entrez): This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C2
• OMIM: 604769

Protein Summary

• Protein general information: P30048  
  • Name: Thioredoxin dependent peroxide reductase, mitochondrial (EC 1.11.1.15) (Antioxidant protein 1) (AOP 1) (HBC189) (Peroxiredoxin III) (Prx III) (Peroxiredoxin 3) (Protein MER5 homolog)
  • Length: 256  
  • Mass: 27693
• Sequence:

  MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGT
  AVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKN
  GGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETH
  GEVCPANWTPDSPTIKPSPAASKEYFQKVNQ

• Structural information:
  • Protein Domains: (63..22-)
    (/note="Thioredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691"-)
  • Interpro: IPR000866  IPR024706  IPR019479  IPR036249  IPR013766  
  • Prosite: PS51352
  • PDB: 5JCG 5UCX
  • PDBsum: 5JCG 5UCX
  • DIP: 33600
  • STRING: ENSP00000298510
• Other Databases: GeneCards:  PRDX3  Malacards:  PRDX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0018171	peptidyl-cysteine oxidation	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0008379	thioredoxin peroxidase activity	IBA	molecular function
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030099	myeloid cell differentiation	IEA	biological process
GO:0001893	maternal placenta development	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042542	response to hydrogen peroxide	IDA	biological process
GO:0033673	negative regulation of kinase activity	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030099	myeloid cell differentiation	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:0042744	hydrogen peroxide catabolic process	IMP	biological process
GO:0019900	kinase binding	IPI	molecular function
GO:0006979	response to oxidative stress	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0034614	cellular response to reactive oxygen species	IMP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0007005	mitochondrion organization	IMP	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	molecular function
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0008785	alkyl hydroperoxide reductase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray