• Gene id: 10933

Gene Summary

• Gene Symbol: MORF4L1   Gene   UCSC   Ensembl
• Aliases: Eaf3, FWP006, HsT17725, MEAF3, MORFRG15, MRG15, S863-6
• Gene name: mortality factor 4 like 1
• Alternate names: mortality factor 4-like protein 1, Esa1p-associated factor 3 homolog, MORF-related gene 15 protein, MORF-related gene on chromosome 15, protein MSL3-1, transcription factor-like protein MRG15,
• Gene location: 15q25.1 (81689546: 81583682)     Exons: 22     NC_000009.12
• OMIM: 607303

Protein Summary

• Protein general information: Q9UBU8  
  • Name: Mortality factor 4 like protein 1 (MORF related gene 15 protein) (Protein MSL3 1) (Transcription factor like protein MRG15)
  • Length: 362  
  • Mass: 41474
• Sequence:

  MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDIVALFP
  VPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTK
  KNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPA
  KKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAP
  HLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

• Structural information:
  • Protein Domains: (191..36-)
    (/note="MRG-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00972"-)
  • Interpro: IPR016197  IPR008676  IPR038011  IPR038217  IPR026541   IPR025995  
  • Prosite: PS51640
  • PDB: 2AQL 2EFI 2F5J 2F5K 2LKM 2N1D 6AGO 6INE
  • PDBsum: 2AQL 2EFI 2F5J 2F5K 2LKM 2N1D 6AGO 6INE
  • DIP: 29017
  • STRING: ENSP00000331310
• Other Databases: GeneCards:  MORF4L1  Malacards:  MORF4L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035267	NuA4 histone acetyltransferase complex	IBA	cellular component
GO:0000123	histone acetyltransferase complex	IBA	cellular component
GO:0006342	chromatin silencing	IBA	biological process
GO:0016573	histone acetylation	IBA	biological process
GO:0016575	histone deacetylation	IBA	biological process
GO:0043967	histone H4 acetylation	IBA	biological process
GO:0043968	histone H2A acetylation	IBA	biological process
GO:0000724	double-strand break repair via homologous recombination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016580	Sin3 complex	IEA	cellular component
GO:0035267	NuA4 histone acetyltransferase complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016580	Sin3 complex	IDA	cellular component
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0016575	histone deacetylation	IDA	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray