• Gene id: 10928

Gene Summary

• Gene Symbol: RALBP1   Gene   UCSC   Ensembl
• Aliases: RIP1, RLIP1, RLIP76
• Gene name: ralA binding protein 1
• Alternate names: ralA-binding protein 1, 76 kDa Ral-interacting protein, DNP-SG ATPase, dinitrophenyl S-glutathione ATPase, ral-interacting protein 1,
• Gene location: 18p11.22 (4366673: 4269216)     Exons: 6     NC_000017.11
• Gene summary(Entrez): RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL (see RALA; MIM 179550). Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive
• OMIM: 605801

Protein Summary

• Protein general information: Q15311  
  • Name: RalA binding protein 1 (RalBP1) (76 kDa Ral interacting protein) (Dinitrophenyl S glutathione ATPase) (DNP SG ATPase) (Ral interacting protein 1)
  • Length: 655  
  • Mass: 76063
  • Tissue specificity: Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes. {ECO
• Sequence:

  MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKF
  KKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKK
  SKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGM
  KCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
  QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQ
  VMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQE
  CETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQ
  SRQQHGRSETEEYSSESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAK
  AEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI

• Structural information:
  • Protein Domains: (192..38-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR039767  IPR008936  IPR000198  
  • Prosite: PS50238
  • PDB: 2KWH 2KWI 2MBG
  • PDBsum: 2KWH 2KWI 2MBG
  • STRING: ENSP00000019317
• Other Databases: GeneCards:  RALBP1  Malacards:  RALBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IDA	molecular function
GO:0017160	Ral GTPase binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0007264	small GTPase mediated signal transduction	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0017160	Ral GTPase binding	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042626	ATPase-coupled transmembrane transporter activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:0055085	transmembrane transport	IDA	biological process
GO:0055085	transmembrane transport	IDA	biological process
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:1900753	doxorubicin transport	IDA	biological process
GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane	IDA	biological process
GO:0022857	transmembrane transporter activity	IDA	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042626	ATPase-coupled transmembrane transporter activity	TAS	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0048365	Rac GTPase binding	IPI	molecular function
GO:0007264	small GTPase mediated signal transduction	IPI	biological process
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04014	Ras signaling pathway
hsa05212	Pancreatic cancer

Diseases

Associated diseases	References
urinary bladder cancer	PMID:17606711
pancreatic adenocarcinoma	PMID:22509328
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq