• Gene id: 10926

Gene Summary

• Gene Symbol: DBF4   Gene   UCSC   Ensembl
• Aliases: ASK, CHIF, DBF4A, ZDBF1
• Gene name: DBF4 zinc finger
• Alternate names: protein DBF4 homolog A, DBF4 homolog, DBF4 zinc finger A, DBF4-type zinc finger-containing protein 1, activator of S phase kinase, chiffon homolog A, zinc finger, DBF-type containing 1,
• Gene location: 7q21.12 (67343823: 67174297)     Exons: 40     NC_000008.11
• OMIM: 604281

Protein Summary

• Protein general information: Q9UBU7  
  • Name: Protein DBF4 homolog A (Activator of S phase kinase) (Chiffon homolog A) (DBF4 type zinc finger containing protein 1)
  • Length: 674  
  • Mass: 76858
  • Tissue specificity: Highly expressed in testis and thymus. Expressed also in most cancer cells lines. {ECO
• Sequence:

  MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRV
  EEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVCLSRGKLLVEKAIKDH
  DFIPSNSILSNALSWGVKILHIDDIRYYIEQKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDM
  SQLYRPFYLQLTNMPFINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
  QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSPVSASVLKKTEQKEKV
  ELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQ
  LPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHS
  IFTHDSGLITINSSQEHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
  EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLTAFFSSPSTSTFTGF

• Structural information:
  • Protein Domains: (40..12-)
    (/note="BRCT-1)
    (154..17-)
    (/note="BRCT-2")
  • Interpro: IPR006572  IPR038545  
  • Prosite: PS51265
  • PDB: 4F99 4F9A 4F9B 4F9C
  • PDBsum: 4F99 4F9A 4F9B 4F9C
  • DIP: 31205
  • STRING: ENSP00000265728
• Other Databases: GeneCards:  DBF4  Malacards:  DBF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0031431	Dbf4-dependent protein kinase complex	IBA	cellular component
GO:1901987	regulation of cell cycle phase transition	IBA	biological process
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IBA	biological process
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R