• Gene id: 10923

Gene Summary

• Gene Symbol: SUB1   Gene   UCSC   Ensembl
• Aliases: P15, PC4, p14
• Gene name: SUB1 regulator of transcription
• Alternate names: activated RNA polymerase II transcriptional coactivator p15, SUB1 homolog, transcriptional regulator, activated RNA polymerase II transcription cofactor 4, positive cofactor 4,
• Gene location: 5p13.3 (18480929: 18485998)     Exons: 1     NC_000001.11
• OMIM: 600503

Protein Summary

• Protein general information: P53999  
  • Name: Activated RNA polymerase II transcriptional coactivator p15 (Positive cofactor 4) (PC4) (SUB1 homolog) (p14)
  • Length: 127  
  • Mass: 14395
• Sequence:

  MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVR
  DFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

• Structural information:
  • Interpro: IPR003173  IPR009044  
  • PDB: 1PCF 2C62 2PHE 4USG
  • PDBsum: 1PCF 2C62 2PHE 4USG
  • DIP: 29044
  • STRING: ENSP00000265073
• Other Databases: GeneCards:  SUB1  Malacards:  SUB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051053	negative regulation of DNA metabolic process	IDA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IBA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060395	SMAD protein signal transduction	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)