• Gene id: 10920

Gene Summary

• Gene Symbol: COPS8   Gene   UCSC   Ensembl
• Aliases: COP9, CSN8, SGN8
• Gene name: COP9 signalosome subunit 8
• Alternate names: COP9 signalosome complex subunit 8, COP9 constitutive photomorphogenic homolog subunit 8, COP9 homolog, JAB1-containing signalosome subunit 8, hCOP9, signalosome subunit 8,
• Gene location: 2q37.3 (57314804: 57646851)     Exons: 19     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to tha
• OMIM: 616011

Protein Summary

• Protein general information: Q99627  
  • Name: COP9 signalosome complex subunit 8 (SGN8) (Signalosome subunit 8) (COP9 homolog) (hCOP9) (JAB1 containing signalosome subunit 8)
  • Length: 209  
  • Mass: 23226
• Sequence:

  MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIW
  SVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILE
  QGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN

• Structural information:
  • Protein Domains: (8..17-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR033205  IPR033464  IPR000717  
  • Prosite: PS50250
  • PDB: 4D10 4D18 4WSN 6R6H 6R7F 6R7H 6R7I 6R7N
  • PDBsum: 4D10 4D18 4WSN 6R6H 6R7F 6R7H 6R7I 6R7N
  • DIP: 42075
  • STRING: ENSP00000346340
• Other Databases: GeneCards:  COPS8  Malacards:  COPS8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008180	COP9 signalosome	IBA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0000338	protein deneddylation	IDA	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0000338	protein deneddylation	IEA	biological process
GO:0010387	COP9 signalosome assembly	IEA	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)