• Gene id: 10914

Gene Summary

• Gene Symbol: PAPOLA   Gene   UCSC   Ensembl
• Aliases: PAP, PAP-alpha
• Gene name: poly(A) polymerase alpha
• Alternate names: poly(A) polymerase alpha, polynucleotide adenylyltransferase alpha,
• Gene location: 14q32.2 (68054314: 68193846)     Exons: 20     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have b
• OMIM: 605553

Protein Summary

• Protein general information: P51003  
  • Name: Poly(A) polymerase alpha (PAP alpha) (EC 2.7.7.19) (Polynucleotide adenylyltransferase alpha)
  • Length: 745  
  • Mass: 82843
• Sequence:

  MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEW
  IREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVE
  EAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLR
  AIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVW
  DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYI
  VLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDKEEFRTMWVIGLVFKKTENSE
  NLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKRKQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDL
  SMDSDNSMSVPSPTSATKTSPLNSSGSSQGRNSPAPAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTAT
  QPAISPPPKPTVSRVVSSTRLVNPPPRSSGNAATSGNAATKIPTPIVGVKRTSSPHKEESPKKTKTEEDETSEDA
  NCLALSGHDKTEAKEQLDTETSTTQSETIQTAASLLASQKTSSTDLSDIPALPANPIPVIKNSIKLRLNR

• Structural information:
  • Interpro: IPR011068  IPR007012  IPR007010  IPR014492  IPR002934  
  • DIP: 27610 40865
  • STRING: ENSP00000216277
• Other Databases: GeneCards:  PAPOLA  Malacards:  PAPOLA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004652	polynucleotide adenylyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0031440	regulation of mRNA 3'-end processing	IDA	biological process
GO:0006378	mRNA polyadenylation	IDA	biological process
GO:0043631	RNA polyadenylation	ISS	biological process
GO:0030145	manganese ion binding	ISS	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0031123	RNA 3'-end processing	IEA	biological process
GO:0043631	RNA polyadenylation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	TAS	molecular function
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0043631	RNA polyadenylation	IEA	biological process
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006378	mRNA polyadenylation	IDA	biological process
GO:0004652	polynucleotide adenylyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray