• Gene id: 10911

Gene Summary

• Gene Symbol: UTS2   Gene   UCSC   Ensembl
• Aliases: PRO1068, U-II, UCN2, UII
• Gene name: urotensin 2
• Alternate names: urotensin-2, prepro U-II, urotensin II,
• Gene location: 1p36.23 (7913614: 7846344)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is
• OMIM: 604097

Protein Summary

• Protein general information: O95399  
  • Name: Urotensin 2 (Urotensin II) (U II) (UII)
  • Length: 124  
  • Mass: 14296
  • Tissue specificity: Brain specific.
• Sequence:

  MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSST
  NIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV

• Structural information:
  • Interpro: IPR001483  
  • Prosite: PS00984
  • PDB: 6HVB 6HVC
  • PDBsum: 6HVB 6HVC
• Other Databases: GeneCards:  UTS2  Malacards:  UTS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097746	regulation of blood vessel diameter	IBA	biological process
GO:0008217	regulation of blood pressure	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0097746	regulation of blood vessel diameter	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0006936	muscle contraction	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cardiomyopathy	PMID:12791592
Pre-eclampsia	PMID:15866083
Hypertension	PMID:15201550
Heart disease	PMID:16508659
Gestational diabetes	PMID:17327028
Asthma	PMID:17045018
Carotid artery disease	PMID:18338983
congestive heart failure	PMID:16364499
Diabetic retinopathy	PMID:18338983
type 2 diabetes mellitus	PMID:15476950
type 2 diabetes mellitus	PMID:15476949
type 2 diabetes mellitus	PMID:18067077
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R