• Gene id: 10910

Gene Summary

• Gene Symbol: SUGT1   Gene   UCSC   Ensembl
• Aliases: SGT1
• Gene name: SGT1 homolog, MIS12 kinetochore complex assembly cochaperone
• Alternate names: protein SGT1 homolog, SGT1, suppressor of G2 allele of SKP1, putative 40-6-3 protein, suppressor of G2 allele of SKP1, S. cerevisiae, homolog of,
• Gene location: 13q14.3 (121354208: 121308244)     Exons: 18     NC_000012.12
• Gene summary(Entrez): This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudoge
• OMIM: 604098

Protein Summary

• Protein general information: Q9Y2Z0  
  • Name: Protein SGT1 homolog (Protein 40 6 3) (Sgt1) (Suppressor of G2 allele of SKP1 homolog)
  • Length: 365  
  • Mass: 41024
• Sequence:

  MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELN
  PNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVW
  IKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELL
  HPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKN
  EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY

• Structural information:
  • Protein Domains: (169..25-)
    (/note="CS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00547-)
    (276..36-)
    (/note="SGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00386"-)
  • Interpro: IPR007052  IPR008978  IPR007699  IPR013026  IPR011990   IPR019734  
  • Prosite: PS51203 PS51048 PS50005 PS50293
  • PDB: 1RL1
  • PDBsum: 1RL1
  • DIP: 53799
  • STRING: ENSP00000367208
• Other Databases: GeneCards:  SUGT1  Malacards:  SUGT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050821	protein stabilization	IBA	biological process
GO:0031647	regulation of protein stability	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000151	ubiquitin ligase complex	TAS	cellular component
GO:0000776	kinetochore	TAS	cellular component
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031647	regulation of protein stability	IDA	biological process
GO:0043947	positive regulation by host of symbiont catalytic activity	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray