• Gene id: 10900

Gene Summary

• Gene Symbol: RUNDC3A   Gene   UCSC   Ensembl
• Aliases: RAP2IP, RPIP-8, RPIP8
• Gene name: RUN domain containing 3A
• Alternate names: RUN domain-containing protein 3A, RaP2 interacting protein 8, rap2-interacting protein 8,
• Gene location: 17q21.31 (44308558: 44318669)     Exons: 13     NC_000017.11

Protein Summary

• Protein general information: Q59EK9  
  • Name: RUN domain containing protein 3A (Rap2 interacting protein 8) (RPIP 8)
  • Length: 446  
  • Mass: 49747
• Sequence:

  MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKA
  CAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDTR
  TTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAES
  STSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
  QREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKLYRRHSFMSTEPLSA
  EASLSSDSQRLGEGTRDEEPWGPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS

• Structural information:
  • Protein Domains: (52..18-)
    (/note="RUN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00178"-)
  • Interpro: IPR004012  IPR037213  
  • Prosite: PS50826
  • STRING: ENSP00000410862
• Other Databases: GeneCards:  RUNDC3A  Malacards:  RUNDC3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0010753	positive regulation of cGMP-mediated signaling	IBA	biological process
GO:0030695	GTPase regulator activity	TAS	molecular function
GO:0007264	small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0010753	positive regulation of cGMP-mediated signaling	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray