• Gene id: 10899

Gene Summary

• Gene Symbol: JTB   Gene   UCSC   Ensembl
• Aliases: HJTB, HSPC222, PAR, hJT
• Gene name: jumping translocation breakpoint
• Alternate names: protein JTB, jumping translocation breakpoint protein, prostate androgen-regulated protein,
• Gene location: 1q21.3 (153977673: 153974268)     Exons: 5     NC_000001.11
• OMIM: 604671

Protein Summary

• Protein general information: O76095  
  • Name: Protein JTB (Jumping translocation breakpoint protein) (Prostate androgen regulated protein) (PAR protein)
  • Length: 146  
  • Mass: 16358
  • Tissue specificity: Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts. {ECO
• Sequence:

  MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECG
  PTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI

• Structural information:
  • Interpro: IPR008657  
  • PDB: 2KJX
  • PDBsum: 2KJX
  • STRING: ENSP00000271843
• Other Databases: GeneCards:  JTB  Malacards:  JTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	colocalizes with
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005819	spindle	IBA	colocalizes with
GO:0030496	midbody	IBA	cellular component
GO:0005813	centrosome	IDA	colocalizes with
GO:0030496	midbody	IDA	cellular component
GO:0019901	protein kinase binding	IDA	molecular function
GO:0005819	spindle	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0045860	positive regulation of protein kinase activity	IMP	biological process
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray