• Gene id: 10898

Gene Summary

• Gene Symbol: CPSF4   Gene   UCSC   Ensembl
• Aliases: CPSF30, NAR, NEB-1, NEB1
• Gene name: cleavage and polyadenylation specific factor 4
• Alternate names: cleavage and polyadenylation specificity factor subunit 4, CPSF 30 kDa subunit, NS1 effector domain-binding protein 1, cleavage and polyadenylation specific factor 4, 30kDa, cleavage and polyadenylation specificity factor 30 kDa subunit, no arches homolog, no a,
• Gene location: 7q22.1 (99438911: 99457376)     Exons: 9     NC_000007.14
• Gene summary(Entrez): Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific
• OMIM: 603052

Protein Summary

• Protein general information: O95639  
  • Name: Cleavage and polyadenylation specificity factor subunit 4 (Cleavage and polyadenylation specificity factor 30 kDa subunit) (CPSF 30 kDa subunit) (NS1 effector domain binding protein 1) (Neb 1) (No arches homolog)
  • Length: 269  
  • Mass: 30255
• Sequence:

  MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGL
  CKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVN
  YLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVM
  QSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ

• Structural information:
  • Interpro: IPR041686  IPR000571  IPR036855  IPR001878  IPR036875  
  • Prosite: PS50103 PS50158
  • PDB: 2D9N 2RHK 6DNH 6FBS 6FUW 6URG 6URO
  • PDBsum: 2D9N 2RHK 6DNH 6FBS 6FUW 6URG 6URO
  • DIP: 48675
  • STRING: ENSP00000292476
• Other Databases: GeneCards:  CPSF4  Malacards:  CPSF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098789	pre-mRNA cleavage required for polyadenylation	IBA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IBA	cellular component
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0046778	modification by virus of host mRNA processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)