About Us

Search Result


Gene id 10897
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol YIF1A   Gene   UCSC   Ensembl
Aliases 54TM, FinGER7, YIF1, YIF1P
Gene name Yip1 interacting factor homolog A, membrane trafficking protein
Alternate names protein YIF1A, 54TMp, YIP1-interacting factor homolog A, Yip1p-interacting factor, putative Rab5-interacting protein, putative transmembrane protein 54TMp,
Gene location 11q13.2 (66289142: 66284579)     Exons: 8     NC_000011.10

Protein Summary

Protein general information O95070  

Name: Protein YIF1A (54TMp) (YIP1 interacting factor homolog A)

Length: 293  Mass: 32011

Sequence MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHGK
DMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEVQYSRDAPLPPRQDLNAPDLYIPTMAFITYV
LLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGLYLATVRSDLSTFHLLAYSGYKYVGMILSVLTGLLF
GSDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR
Structural information
Interpro:  IPR005578  
MINT:  
STRING:   ENSP00000366098
Other Databases GeneCards:  YIF1A  Malacards:  YIF1A

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005789 endoplasmic reticulum mem
brane
IBA cellular component
GO:0005793 endoplasmic reticulum-Gol
gi intermediate compartme
nt
IBA cellular component
GO:0030173 integral component of Gol
gi membrane
IBA cellular component
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IBA biological process
GO:0030134 COPII-coated ER to Golgi
transport vesicle
IBA cellular component
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IEA biological process
GO:0005794 Golgi apparatus
IEA cellular component
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0016192 vesicle-mediated transpor
t
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0015031 protein transport
IEA biological process
GO:0036498 IRE1-mediated unfolded pr
otein response
TAS biological process
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0000139 Golgi membrane
IEA cellular component
GO:0033116 endoplasmic reticulum-Gol
gi intermediate compartme
nt membrane
IEA cellular component
GO:0005793 endoplasmic reticulum-Gol
gi intermediate compartme
nt
IDA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract