• Gene id: 10894

Gene Summary

• Gene Symbol: LYVE1   Gene   UCSC   Ensembl
• Aliases: CRSBP-1, HAR, LYVE-1, XLKD1
• Gene name: lymphatic vessel endothelial hyaluronan receptor 1
• Alternate names: lymphatic vessel endothelial hyaluronic acid receptor 1, cell surface retention sequence binding protein-1, extracellular link domain-containing 1, extracellular link domain-containing protein 1, hyaluronic acid receptor,
• Gene location: 11p15.4 (10568664: 10556965)     Exons: 14     NC_000011.10
• Gene summary(Entrez): This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provi
• OMIM: 605702

Protein Summary

• Protein general information: Q9Y5Y7  
  • Name: Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE 1) (Cell surface retention sequence binding protein 1) (CRSBP 1) (Extracellular link domain containing protein 1) (Hyaluronic acid receptor)
  • Length: 322  
  • Mass: 35213
  • Tissue specificity: Mainly expressed in endothelial cells lining lymphatic vessels. {ECO
• Sequence:

  MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVE
  TALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPI
  FNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAA
  FKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKT
  DKNPEESKSPSKTTVRCLEAEV

• Structural information:
  • Protein Domains: (40..13-)
    (/note="Link-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00323"-)
  • Interpro: IPR016186  IPR016187  IPR000538  
  • Prosite: PS50963
  • STRING: ENSP00000256178
• Other Databases: GeneCards:  LYVE1  Malacards:  LYVE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005540	hyaluronic acid binding	IBA	molecular function
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0007160	cell-matrix adhesion	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006027	glycosaminoglycan catabolic process	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)