• Gene id: 10892

Gene Summary

• Gene Symbol: MALT1   Gene   UCSC   Ensembl
• Aliases: IMD12, MLT, MLT1, PCASP1
• Gene name: MALT1 paracaspase
• Alternate names: mucosa-associated lymphoid tissue lymphoma translocation protein 1, MALT lymphoma-associated translocation, MALT1 protease, caspase-like protein, mucosa associated lymphoid tissue lymphoma translocation gene 1, paracaspase, paracaspase-1,
• Gene location: 18q21.32 (58671385: 58753805)     Exons: 19     NC_000018.10
• Gene summary(Entrez): This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoi
• OMIM: 604860

Protein Summary

• Protein general information: Q9UDY8  
  • Name: Mucosa associated lymphoid tissue lymphoma translocation protein 1 (EC 3.4.22. ) (MALT lymphoma associated translocation) (Paracaspase)
  • Length: 824  
  • Mass: 92,272
• Sequence:

  MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLE
  QCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRA
  TGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSES
  KLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
  SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQ
  LDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQ
  EKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKI
  TVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
  QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSL
  QKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHY
  HSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK

• Structural information:
  • Protein Domains: Death (39-126)
    Ig-like (125-201)
    Ig-like (212-305)
  • Interpro: IPR029030  IPR011029  IPR007110  IPR036179  IPR013783   IPR003599  IPR003598  IPR033540  IPR037940  IPR001309  
  • Prosite: PS50208 PS50835
  • CDD: cd08783
  • PDB: 2G7R 3BFO 3K0W 3UO8 3UOA 3V4O 3V55 4I1P 4I1R
  • PDBsum: 2G7R 3BFO 3K0W 3UO8 3UOA 3V4O 3V55 4I1P 4I1R
  • DIP: 42833
  • STRING: ENSP00000319279
• Other Databases: GeneCards:  MALT1  Malacards:  MALT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001923	B-1 B cell differentiation	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002237	response to molecule of bacterial origin	IEA	biological process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological process
GO:0004197	cysteine-type endopeptidase activity	NAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006952	defense response	NAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0009620	response to fungus	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0031398	positive regulation of protein ubiquitination	NAS	biological process
GO:0032449	CBM complex	NAS	cellular component
GO:0032743	positive regulation of interleukin-2 production	IMP	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043621	protein self-association	IPI	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050856	regulation of T cell receptor signaling pathway	IEA	biological process
GO:0050870	positive regulation of T cell activation	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051168	nuclear export	IDA	biological process
GO:0051259	protein oligomerization	IDA	biological process
GO:0019209	kinase activator activity	IMP	molecular function
GO:0001923	B-1 B cell differentiation	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002237	response to molecule of bacterial origin	IEA	biological process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological process
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	NAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006952	defense response	NAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0009620	response to fungus	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031398	positive regulation of protein ubiquitination	NAS	biological process
GO:0032449	CBM complex	NAS	cellular component
GO:0032743	positive regulation of interleukin-2 production	IMP	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0042113	B cell activation	IEA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043621	protein self-association	IPI	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050856	regulation of T cell receptor signaling pathway	IEA	biological process
GO:0050870	positive regulation of T cell activation	IEA	biological process
GO:0050870	positive regulation of T cell activation	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051168	nuclear export	IDA	biological process
GO:0051259	protein oligomerization	IDA	biological process
GO:0019209	kinase activator activity	IMP	molecular function
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological process
GO:0004197	cysteine-type endopeptidase activity	NAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004871	signal transducer activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006952	defense response	NAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IMP	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0031398	positive regulation of protein ubiquitination	NAS	biological process
GO:0032449	CBM complex	NAS	cellular component
GO:0032743	positive regulation of interleukin-2 production	IMP	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043621	protein self-association	IPI	molecular function
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050870	positive regulation of T cell activation	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051168	nuclear export	IDA	biological process
GO:0051259	protein oligomerization	IDA	biological process
GO:0019209	kinase activator activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04662	B cell receptor signaling pathway
hsa05152	Tuberculosis

Diseases

Associated diseases	References
Multiple sclerosis	GAD: 21833088
Immunodeficiency	OMIM: 604860
Sperm function	MIK: 15148929
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Sperm function	MIK: 15148929
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15148929	Sperm function			117 (18 fertile men, 99 infertile men)	Male infertility	MLT
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray