• Gene id: 10888

Gene Summary

• Gene Symbol: GPR83   Gene   UCSC   Ensembl
• Aliases: GIR, GPR72
• Gene name: G protein-coupled receptor 83
• Alternate names: probable G-protein coupled receptor 83, G-protein coupled receptor 72, glucocorticoid induced receptor,
• Gene location: 11q21 (94401418: 94377315)     Exons: 4     NC_000011.10
• OMIM: 605569

Protein Summary

• Protein general information: Q9NYM4  
  • Name: Probable G protein coupled receptor 83 (G protein coupled receptor 72)
  • Length: 423  
  • Mass: 48339
  • Tissue specificity: Brain specific.
• Sequence:

  MVPHLLLLCLLPLVRATEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRRYGAESQNPTVKALLI
  VAYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTWIFGKGMCHVSRFA
  QYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWTMATFFSLPHAICQKLFTFKYSEDIVRSLCL
  PDFPEPADLFWKYLDLATFILLYILPLLIISVAYARVAKKLWLCNMIGDVTTEQYFALRRKKKKTIKMLMLVVVL
  FALCWFPLNCYVLLLSSKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALLSMCQRPPKPQEDRPP
  SPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIVTMS

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000611  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000243673
• Other Databases: GeneCards:  GPR83  Malacards:  GPR83

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005929	cilium	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0097730	non-motile cilium	IEA	cellular component
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)