• Gene id: 10886

Gene Summary

• Gene Symbol: NPFFR2   Gene   UCSC   Ensembl
• Aliases: GPR74, HLWAR77, NPFF2, NPGPR
• Gene name: neuropeptide FF receptor 2
• Alternate names: neuropeptide FF receptor 2, G-protein coupled receptor 74, G-protein coupled receptor HLWAR77, neuropeptide FF 2, neuropeptide G-protein coupled receptor,
• Gene location: 4q13.3 (72031803: 72148200)     Exons: 3     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternati
• OMIM: 607449

Protein Summary

• Protein general information: Q9Y5X5  
  • Name: Neuropeptide FF receptor 2 (G protein coupled receptor 74) (G protein coupled receptor HLWAR77) (Neuropeptide G protein coupled receptor)
  • Length: 522  
  • Mass: 60270
  • Tissue specificity: Isoform 1 is abundant in placenta. Relatively highly expressed in thymus, testis, and small intestine. Expressed at low levels in several tissues including spleen, prostate, brain, heart, ovary, colon, kidney, lung, liver and pancreas
• Sequence:

  MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKSSWSRS
  RDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIF
  IISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGL
  VQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN
  KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKII
  KMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAF
  QLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR005395  IPR005397  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000307822
• Other Databases: GeneCards:  NPFFR2  Malacards:  NPFFR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0008188	neuropeptide receptor activity	IEA	molecular function
GO:0031628	opioid receptor binding	IEA	molecular function
GO:0043408	regulation of MAPK cascade	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045761	regulation of adenylate cyclase activity	IEA	biological process
GO:2000479	regulation of cAMP-dependent protein kinase activity	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0009582	detection of abiotic stimulus	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881