• Gene id: 1088

Gene Summary

• Gene Symbol: CEACAM8   Gene   UCSC   Ensembl
• Aliases: CD66b, CD67, CGM6, NCA-95
• Gene name: CEA cell adhesion molecule 8
• Alternate names: carcinoembryonic antigen-related cell adhesion molecule 8, CD67 antigen, carcinoembryonic antigen CGM6, carcinoembryonic antigen gene family member 6, carcinoembryonic antigen related cell adhesion molecule 8, non-specific cross-reacting antigen NCA-95,
• Gene location: 19q13.2 (42595156: 42580242)     Exons: 8     NC_000019.10
• OMIM: 615747

Protein Summary

• Protein general information: P31997  
  • Name: Carcinoembryonic antigen related cell adhesion molecule 8 (CD67 antigen) (Carcinoembryonic antigen CGM6) (Non specific cross reacting antigen NCA 95) (CD antigen CD66b)
  • Length: 349  
  • Mass: 38154
  • Tissue specificity: Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
• Sequence:

  MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDA
  NRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSIS
  SNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANF
  SDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACH
  TTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000255,-ECO:0000305|PubMed:2208113)
    (145..23-)
    1 (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114-)
    (237..31-)
    2 (/note="Ig-like-C2-type)
    (/evidence="ECO:000-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • PDB: 2DKS 4WTZ 4Y88 4YIQ
  • PDBsum: 2DKS 4WTZ 4Y88 4YIQ
  • STRING: ENSP00000244336
• Other Databases: GeneCards:  CEACAM8  Malacards:  CEACAM8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881