• Gene id: 10879

Gene Summary

• Gene Symbol: SMR3B   Gene   UCSC   Ensembl
• Aliases: P-B, PBII, PRL3, PROL3, SMR1B
• Gene name: submaxillary gland androgen regulated protein 3B
• Alternate names: submaxillary gland androgen-regulated protein 3B, proline rich 3, proline-rich peptide P-B, proline-rich protein 3, salivary proline-rich protein, submaxillary gland androgen regulated protein 3 homolog B,
• Gene location: 4q13.3 (70383130: 70390243)     Exons: 3     NC_000004.12
• OMIM: 611593

Protein Summary

• Protein general information: P02814  
  • Name: Submaxillary gland androgen regulated protein 3B (Proline rich peptide P B) (Proline rich protein 3) [Cleaved into: Peptide P A; Peptide D1A]
  • Length: 79  
  • Mass: 8188
  • Tissue specificity: Secreted into saliva by submaxillary gland. Not expressed in heart, brain, lung, liver, skeletal muscle, Kidney, pancreas or placenta. {ECO
• Sequence:

  MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPP
  PPQP

• Structural information:
  • Interpro: IPR026288  
  • STRING: ENSP00000302400
• Other Databases: GeneCards:  SMR3B  Malacards:  SMR3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004866	endopeptidase inhibitor activity	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0051930	regulation of sensory perception of pain	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)