• Gene id: 10875

Gene Summary

• Gene Symbol: FGL2   Gene   UCSC   Ensembl
• Aliases: T49, pT49
• Gene name: fibrinogen like 2
• Alternate names: fibroleukin, fibrinogen-like protein 2,
• Gene location: 7q11.23 (77199818: 77193368)     Exons: 6     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric comp
• OMIM: 605351

Protein Summary

• Protein general information: Q14314  
  • Name: Fibroleukin (Fibrinogen like protein 2) (pT49)
  • Length: 439  
  • Mass: 50229
  • Tissue specificity: Constitutively expressed in cytotoxic T-cells.
• Sequence:

  MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRI
  EEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEE
  INVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSE
  TYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
  RIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYY
  SSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

• Structural information:
  • Protein Domains: (204..43-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR033083  IPR036056  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • STRING: ENSP00000248598
• Other Databases: GeneCards:  FGL2  Malacards:  FGL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005577	fibrinogen complex	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050687	negative regulation of defense response to virus	IEA	biological process
GO:0043381	negative regulation of memory T cell differentiation	IEA	biological process
GO:0002617	negative regulation of macrophage antigen processing and presentation	IEA	biological process
GO:0002605	negative regulation of dendritic cell antigen processing and presentation	IEA	biological process
GO:0002381	immunoglobulin production involved in immunoglobulin mediated immune response	IEA	biological process
GO:0002291	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881