• Gene id: 10874

Gene Summary

• Gene Symbol: NMU   Gene   UCSC   Ensembl
• Gene name: neuromedin U
• Alternate names: neuromedin-U, neuromedin U precursor-related peptide/neuromedin U preproprotein, prepro-NMU,
• Gene location: 4q12 (55636792: 55595230)     Exons: 13     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the neuromedin family of neuropeptides. The encoded protein is a precursor that is proteolytically processed to generate a biologically active neuropeptide that plays a role in pain, stress, immune-mediated inflammatory disea
• OMIM: 605103

Protein Summary

• Protein general information: P48645  
  • Name: Neuromedin U [Cleaved into: Neuromedin precursor related peptide 36 (NURP36); Neuromedin precursor related peptide 33 (NURP33); Neuromedin U 25 (NmU 25)]
  • Length: 174  
  • Mass: 19741
  • Tissue specificity: Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
• Sequence:

  MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQAS
  NALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQS
  PFASQSRGYFLFRPRNGRRSAGFI

• Structural information:
  • Interpro: IPR018070  IPR042384  IPR008200  
  • Prosite: PS00967
  • STRING: ENSP00000264218
• Other Databases: GeneCards:  NMU  Malacards:  NMU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0042922	neuromedin U receptor binding	IBA	molecular function
GO:0043195	terminal bouton	IBA	cellular component
GO:0045987	positive regulation of smooth muscle contraction	IBA	biological process
GO:0050806	positive regulation of synaptic transmission	IBA	biological process
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0042922	neuromedin U receptor binding	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903999	negative regulation of eating behavior	IEA	biological process
GO:1902722	positive regulation of prolactin secretion	IEA	biological process
GO:0120069	positive regulation of stomach fundus smooth muscle contraction	IEA	biological process
GO:0120061	negative regulation of gastric emptying	IEA	biological process
GO:0060455	negative regulation of gastric acid secretion	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0046887	positive regulation of hormone secretion	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0042922	neuromedin U receptor binding	IEA	molecular function
GO:0042755	eating behavior	IEA	biological process
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0060259	regulation of feeding behavior	IEA	biological process
GO:2000821	regulation of grooming behavior	IEA	biological process
GO:2000252	negative regulation of feeding behavior	IEA	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:0097009	energy homeostasis	IEA	biological process
GO:0031652	positive regulation of heat generation	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0009648	photoperiodism	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0003084	positive regulation of systemic arterial blood pressure	IEA	biological process
GO:0001696	gastric acid secretion	IEA	biological process
GO:2000821	regulation of grooming behavior	IEA	biological process
GO:0097009	energy homeostasis	IEA	biological process
GO:0001659	temperature homeostasis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0031839	type 1 neuromedin U receptor binding	IDA	molecular function
GO:0031839	type 1 neuromedin U receptor binding	IDA	molecular function
GO:0031840	type 2 neuromedin U receptor binding	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
obesity	PMID:16984985
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)