• Gene id: 1087

Gene Summary

• Gene Symbol: CEACAM7   Gene   UCSC   Ensembl
• Aliases: CGM2
• Gene name: CEA cell adhesion molecule 7
• Alternate names: carcinoembryonic antigen-related cell adhesion molecule 7, carcinoembryonic antigen CGM2, carcinoembryonic antigen gene family member 2, carcinoembryonic antigen related cell adhesion molecule 7,
• Gene location: 19q13.2 (41688269: 41673302)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictiv

SNPs

rs222859

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7294475C>A
NC_000017.10   g.7197794C>A
NM_015982.4   c.26G>T
NM_015982.3   c.26G>T
XM_017024713.2   c.26G>T
NP_057066.2   p.Gly9Val
XP_016880202.1   p.Gly9Val|SEQ=[C/A]|GENE=YBX2

rs605059

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.42554888G>A
NC_000017.11   g.42554888G>C
NC_000017.11   g.42554888G>T
NC_000017.10   g.40706906G>A
NC_000017.10   g.40706906G>C
NC_000017.10   g.40706906G>T
NM_000413.3   c.937G>A
NM_000413.3   c.937G>C
NM_000413.3   c.937G>T
NM_000413.4   c.937G>A
NM_0  

Protein Summary

• Protein general information: Q14002  
  • Name: Carcinoembryonic antigen related cell adhesion molecule 7 (Carcinoembryonic antigen CGM2)
  • Length: 265  
  • Mass: 29379
  • Tissue specificity: Expressed in columnar epithelial cells of the colon (at protein level) (PubMed
• Sequence:

  MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHA
  NYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSI
  TSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGAS
  RSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI

• Structural information:
  • Protein Domains: (36..14-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000250|UniProtKB:P31997-)
    (146..23-)
    (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 4Y89
  • PDBsum: 4Y89
  • STRING: ENSP00000006724
• Other Databases: GeneCards:  CEACAM7  Malacards:  CEACAM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)