• Gene id: 10868

Gene Summary

• Gene Symbol: USP20   Gene   UCSC   Ensembl
• Aliases: LSFR3A, VDU2, hVDU2
• Gene name: ubiquitin specific peptidase 20
• Alternate names: ubiquitin carboxyl-terminal hydrolase 20, deubiquitinating enzyme 20, pVHL-interacting deubiquitinating enzyme 2, ubiquitin thioesterase 20, ubiquitin thiolesterase 20, ubiquitin-specific-processing protease 20,
• Gene location: 9q34.11 (129835416: 129881837)     Exons: 27     NC_000009.12
• Gene summary(Entrez): This gene encodes a ubiquitin specific processing protease that was first identified as a substrate of the VHL (von Hippel-Lindau disease) protein E3 ubiquitin ligase complex. In addition to being ubiquitinated by the VHL-E3 ligase complex, this enzyme de
• OMIM: 604814

Protein Summary

• Protein general information: Q9Y2K6  
  • Name: Ubiquitin carboxyl terminal hydrolase 20 (EC 3.4.19.12) (Deubiquitinating enzyme 20) (Ubiquitin thioesterase 20) (Ubiquitin specific processing protease 20) (VHL interacting deubiquitinating enzyme 2) (hVDU2)
  • Length: 914  
  • Mass: 102003
• Sequence:

  MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKHNLTVN
  LTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNL
  GNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFR
  GYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
  GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPC
  RTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSAGSRRRKEQRYRSVISDIFD
  GSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVV
  SCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
  SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNA
  EGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYID
  DLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWF
  REWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
  LHGEQKIEAETRAV

• Structural information:
  • Protein Domains: (145..68-)
    (/note="USP-)
    (687..78-)
    (/note="DUSP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00613-)
    (789..89-)
    (/note="DUSP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00613"-)
  • Interpro: IPR035927  IPR038765  IPR006615  IPR001394  IPR018200   IPR028889  IPR013083  IPR001607  
  • Prosite: PS51283 PS00972 PS00973 PS50235 PS50271
  • PDB: 6KCZ
  • PDBsum: 6KCZ
  • STRING: ENSP00000313811
• Other Databases: GeneCards:  USP20  Malacards:  USP20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0070536	protein K63-linked deubiquitination	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0071108	protein K48-linked deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IMP	biological process
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq