• Gene id: 10867

Gene Summary

• Gene Symbol: TSPAN9   Gene   UCSC   Ensembl
• Aliases: NET-5, NET5, PP1057
• Gene name: tetraspanin 9
• Alternate names: tetraspanin-9, new EST tetraspan 5, tetraspan NET-5, transmembrane 4 superfamily member tetraspan NET-5, tspan-9,
• Gene location: 12p13.33-p13.32 (3077354: 3286563)     Exons: 12     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 613137

Protein Summary

• Protein general information: O75954  
  • Name: Tetraspanin 9 (Tspan 9) (Tetraspan NET 5)
  • Length: 239  
  • Mass: 26779
  • Tissue specificity: Expressed in megakaryocytes and platelets (at protein level). {ECO
• Sequence:

  MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGCLGA
  IKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGV
  TDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMT
  LFQHIHRTGKKYDA

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000011898
• Other Databases: GeneCards:  TSPAN9  Malacards:  TSPAN9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0097197	tetraspanin-enriched microdomain	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005925	focal adhesion	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq