• Gene id: 10861

Gene Summary

• Gene Symbol: SLC26A1   Gene   UCSC   Ensembl
• Aliases: CAON, EDM4, SAT-1, SAT1
• Gene name: solute carrier family 26 member 1
• Alternate names: sulfate anion transporter 1, solute carrier family 26 (anion exchanger), member 1, solute carrier family 26 (sulfate transporter), member 1, sulfate anion tranporter AT1, sulfate/anion transporter SAT-1 protein,
• Gene location: 4p16.3 (993403: 979072)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. T
• OMIM: 615143

Protein Summary

• Protein general information: Q9H2B4  
  • Name: Sulfate anion transporter 1 (SAT 1) (Solute carrier family 26 member 1)
  • Length: 701  
  • Mass: 75016
  • Tissue specificity: Expressed most abundantly in the kidney and liver, with lower levels in the pancreas, testis, brain, small intestine, colon, and lung. {ECO
• Sequence:

  MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWLRQYRPREYLAGDVMS
  GLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRHVSVGIFSLLCLMVGQVVDRELQLAGFDPSQ
  DGLQPGANSSTLNGSAAMLDCGRDCYAIRVATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILT
  SQLKHLLGVRIPRHQGPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
  VATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVAAAFSISLAEMFARSHGYSVRANQ
  ELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSATVVLLVLLALAPLFHDLQRSVLACVIVVSL
  RGALRKVWDLPRLWRMSPADALVWAGTAATCMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDTAFYEDA
  TEFEGLVPEPGVRVFRFGGPLYYANKDFFLQSLYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRA
  ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYGALGISLLLACCSPPVRDILSRGGFLGEGPGDTAEEEQ
  LFLSVHDAVQTARARHRELEATDAHL

• Structural information:
  • Protein Domains: (527..68-)
    (/note="STAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00198"-)
  • Interpro: IPR018045  IPR011547  IPR001902  IPR030331  IPR002645   IPR036513  
  • Prosite: PS01130 PS50801
  • STRING: ENSP00000354721
• Other Databases: GeneCards:  SLC26A1  Malacards:  SLC26A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015108	chloride transmembrane transporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0015301	anion:anion antiporter activity	IBA	molecular function
GO:0019531	oxalate transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015106	bicarbonate transmembrane transporter activity	IBA	molecular function
GO:0019532	oxalate transport	ISS	biological process
GO:0019531	oxalate transmembrane transporter activity	ISS	molecular function
GO:0015301	anion:anion antiporter activity	ISS	molecular function
GO:0015116	sulfate transmembrane transporter activity	ISS	molecular function
GO:0015108	chloride transmembrane transporter activity	ISS	molecular function
GO:0006821	chloride transport	ISS	biological process
GO:0008272	sulfate transport	ISS	biological process
GO:0006821	chloride transport	IEA	biological process
GO:0015108	chloride transmembrane transporter activity	IEA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IEA	molecular function
GO:0019531	oxalate transmembrane transporter activity	IEA	molecular function
GO:0019532	oxalate transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0050428	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0015701	bicarbonate transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	TAS	cellular component

Diseases

Associated diseases	References
Calcium oxalate nephrolithiasis	KEGG:H02145
Calcium oxalate nephrolithiasis	KEGG:H02145
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq