• Gene id: 10857

Gene Summary

• Gene Symbol: PGRMC1   Gene   UCSC   Ensembl
• Aliases: Dap1, HPR6.6, IZA, MPR
• Gene name: progesterone receptor membrane component 1
• Alternate names: membrane-associated progesterone receptor component 1, progesterone binding protein,
• Gene location: Xq24 (119236244: 119244465)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]
• OMIM: 300435

Protein Summary

• Protein general information: O00264  
  • Name: Membrane associated progesterone receptor component 1 (mPR) (Dap1) (IZA)
  • Length: 195  
  • Mass: 21671
  • Tissue specificity: Widely expressed, with highest expression in liver and kidney. Expressed by endometrial glands and stroma (at protein level) (PubMed
• Sequence:

  MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTP
  AELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQ
  ETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

• Structural information:
  • Protein Domains: (72..17-)
    heme-binding" (/note="Cytochrome-b5)
  • Interpro: IPR001199  IPR036400  
  • PDB: 4X8Y
  • PDBsum: 4X8Y
  • STRING: ENSP00000217971
• Other Databases: GeneCards:  PGRMC1  Malacards:  PGRMC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0044297	cell body	ISS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0020037	heme binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0006783	heme biosynthetic process	IDA	biological process
GO:0005741	mitochondrial outer membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005496	steroid binding	IEA	molecular function
GO:0005496	steroid binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0030868	smooth endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881