• Gene id: 10855

Gene Summary

• Gene Symbol: HPSE   Gene   UCSC   Ensembl
• Aliases: HPA, HPA1, HPR1, HPSE1, HSE1
• Gene name: heparanase
• Alternate names: heparanase, endo-glucoronidase, heparanase-1,
• Gene location: 4q21.23 (83335152: 83292460)     Exons: 13     NC_000004.12
• Gene summary(Entrez): Heparan sulfate proteoglycans are major components of the basement membrane and extracellular matrix. The protein encoded by this gene is an enzyme that cleaves heparan sulfate proteoglycans to permit cell movement through remodeling of the extracellular
• OMIM: 604724

Protein Summary

• Protein general information: Q9Y251  
  • Name: Heparanase (EC 3.2.1.166) (Endo glucoronidase) (Heparanase 1) (Hpa1) [Cleaved into: Heparanase 8 kDa subunit; Heparanase 50 kDa subunit]
  • Length: 543  
  • Mass: 61149
  • Tissue specificity: Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues. Also expressed in hair follicles, specifically in both Henl
• Sequence:

  MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILL
  GSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQL
  LLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNE
  PNSFLKKADIFINGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
  NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFAAGFMWLDKLGLSARM
  GIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDL
  TLYAINLHNVTKYLRLPYPFSNKQVDKYLLRPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLP
  AFSYSFFVIRNAKVAACI

• Structural information:
  • Interpro: IPR005199  IPR017853  
  • PDB: 5E8M 5E97 5E98 5E9B 5E9C 5L9Y 5L9Z 5LA4 5LA7
  • PDBsum: 5E8M 5E97 5E98 5E9B 5E9C 5L9Y 5L9Z 5LA4 5LA7
  • STRING: ENSP00000384262
• Other Databases: GeneCards:  HPSE  Malacards:  HPSE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0060055	angiogenesis involved in wound healing	IBA	biological process
GO:0030305	heparanase activity	IDA	molecular function
GO:0030200	heparan sulfate proteoglycan catabolic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0004566	beta-glucuronidase activity	TAS	molecular function
GO:0006029	proteoglycan metabolic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0035580	specific granule lumen	TAS	cellular component
GO:0051798	positive regulation of hair follicle development	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0042060	wound healing	IEA	biological process
GO:0033690	positive regulation of osteoblast proliferation	IEA	biological process
GO:0061042	vascular wound healing	IEA	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045545	syndecan binding	IDA	molecular function
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0033690	positive regulation of osteoblast proliferation	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0010575	positive regulation of vascular endothelial growth factor production	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051797	regulation of hair follicle development	IDA	biological process
GO:0030194	positive regulation of blood coagulation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05205	Proteoglycans in cancer
hsa00531	Glycosaminoglycan degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881