• Gene id: 10850

Gene Summary

• Gene Symbol: CCL27   Gene   UCSC   Ensembl
• Aliases: ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
• Gene name: C-C motif chemokine ligand 27
• Alternate names: C-C motif chemokine 27, CC chemokine ILC, IL-11 R-alpha-locus chemokine, IL-11 Ralpha-locus chemokine, chemokine (C-C motif) ligand 27, cutaneous T-cell attracting chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27, small-inducible cyt,
• Gene location: 9p13.3 (34662656: 34661889)     Exons: 3     NC_000009.12
• Gene summary(Entrez): This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine
• OMIM: 600822

Protein Summary

• Protein general information: Q9Y4X3  
  • Name: C C motif chemokine 27 (CC chemokine ILC) (Cutaneous T cell attracting chemokine) (CTACK) (ESkine) (IL 11 R alpha locus chemokine) (Skinkine) (Small inducible cytokine A27)
  • Length: 112  
  • Mass: 12618
  • Tissue specificity: Testis, thymus, placenta, ovary and skin.
• Sequence:

  MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRS
  ICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

• Structural information:
  • Interpro: IPR001811  IPR036048  
  • PDB: 2KUM
  • PDBsum: 2KUM
  • DIP: 5872
  • STRING: ENSP00000259631
• Other Databases: GeneCards:  CCL27  Malacards:  CCL27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008009	chemokine activity	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:2000251	positive regulation of actin cytoskeleton reorganization	IBA	biological process
GO:0071677	positive regulation of mononuclear cell migration	IBA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0060326	cell chemotaxis	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0031728	CCR3 chemokine receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Asthma	PMID:19541356
Atopic dermatitis	PMID:12642842
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray