• Gene id: 10848

Gene Summary

• Gene Symbol: PPP1R13L   Gene   UCSC   Ensembl
• Aliases: IASPP, NKIP1, RAI, RAI4
• Gene name: protein phosphatase 1 regulatory subunit 13 like
• Alternate names: relA-associated inhibitor, NFkB interacting protein 1, PPP1R13B-like protein, inhibitor of ASPP protein, inhibitor of apoptosis stimulating protein of p53, protein iASPP, protein phosphatase 1, regulatory (inhibitor) subunit 13 like, retinoic acid induced 4,
• Gene location: 19q13.32 (45406360: 45379633)     Exons: 15     NC_000019.10
• Gene summary(Entrez): IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM, Mar 2008]

Protein Summary

• Protein general information: Q8WUF5  
  • Name: RelA associated inhibitor (Inhibitor of ASPP protein) (Protein iASPP) (NFkB interacting protein 1) (PPP1R13B like protein)
  • Length: 828  
  • Mass: 89091
  • Tissue specificity: Highly expressed in heart, placenta and prostate. Weakly expressed in brain, liver, skeletal muscle, testis and peripheral blood leukocyte. {ECO
• Sequence:

  MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSI
  PEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSSPRTPLYLQPDAYGSLDRATSPRPRAFDGAG
  SSLGRAPSPRPGPGPLRQQGPPTPFDFLGRAGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGS
  GGSAFAPPLRAQDDLTLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
  KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQPRGAPRQRPIPLSMI
  FKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQPQPQLPPQPQTQPQTPTPAPQHPQQTWPPVN
  EGPPKPPTELEPEPEIEGLLTPVLEAGDVDEGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRG
  SMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
  QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSI
  VDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLAD
  VEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQR
  SKV

• Structural information:
  • Protein Domains: (758..82-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR028320  IPR036028   IPR001452  IPR042722  
  • Prosite: PS50297 PS50088 PS50002
  • CDD: cd11952
  • PDB: 2VGE 6DCX 6HL6 6RZ3
  • PDBsum: 2VGE 6DCX 6HL6 6RZ3
  • DIP: 29586
  • STRING: ENSP00000403902
• Other Databases: GeneCards:  PPP1R13L  Malacards:  PPP1R13L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045597	positive regulation of cell differentiation	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0008134	transcription factor binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003215	cardiac right ventricle morphogenesis	IEA	biological process
GO:0031076	embryonic camera-type eye development	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0003229	ventricular cardiac muscle tissue development	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0042633	hair cycle	IEA	biological process
GO:0048871	multicellular organismal homeostasis	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R