• Gene id: 10845

Gene Summary

• Gene Symbol: CLPX   Gene   UCSC   Ensembl
• Aliases: EPP2
• Gene name: caseinolytic mitochondrial matrix peptidase chaperone subunit X
• Alternate names: ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial, ClpX caseinolytic peptidase X homolog, ClpX caseinolytic protease X homolog, energy-dependent regulator of proteolysis,
• Gene location: 15q22.31 (65185373: 65148218)     Exons: 14     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is part of a protease found in mitochondria. This protease is ATP-dependent and targets specific proteins for degradation. The protease consists of two heptameric rings of the CLPP catalytic subunit sandwiched between two
• OMIM: 615611

Protein Summary

• Protein general information: O76031  
  • Name: ATP dependent Clp protease ATP binding subunit clpX like, mitochondrial
  • Length: 633  
  • Mass: 69224
  • Tissue specificity: Higher expression in skeletal muscle and heart and to a lesser extent in liver, brain, placenta, lung, kidney and pancreas. {ECO
• Sequence:

  MPSCGACTCGAAAVRLITSSLASAQRGISGGRIHMSVLGRLGTFETQILQRAPLRSFTETPAYFASKDGISKDGS
  GDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEP
  ESAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPANLRQQAEVEKQTSLTPRE
  LEIRRREDEYRFTKLLQIAGISPHGNALGASMQQQVNQQIPQEKRGGEVLDSSHDDIKLEKSNILLLGPTGSGKT
  LLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGIHQLRDV
  GGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPSNLGKG
  RRAAAAADLANRSGESNTHQDIEEKDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAV
  IPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEP
  GYIRAPTKESSEEEYDSGVEEEGWPRQADAANS

• Structural information:
  • Protein Domains: (93..14-)
    (/note="ClpX-type-ZB)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01250"-)
  • Interpro: IPR003593  IPR003959  IPR019489  IPR004487  IPR027417  
  • Prosite: PS51902
  • DIP: 50293
  • STRING: ENSP00000300107
• Other Databases: GeneCards:  CLPX  Malacards:  CLPX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0030163	protein catabolic process	IBA	biological process
GO:0016887	ATPase activity	IBA	molecular function
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0005524	ATP binding	IBA	molecular function
GO:0009368	endopeptidase Clp complex	IDA	cellular component
GO:0009368	endopeptidase Clp complex	IDA	cellular component
GO:0046034	ATP metabolic process	IDA	biological process
GO:0016887	ATPase activity	IDA	molecular function
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016887	ATPase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0016504	peptidase activator activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0004176	ATP-dependent peptidase activity	IDA	contributes to
GO:0051603	proteolysis involved in cellular protein catabolic process	IDA	biological process
GO:0016504	peptidase activator activity	IDA	molecular function
GO:0009841	mitochondrial endopeptidase Clp complex	IDA	cellular component
GO:0005524	ATP binding	ISS	molecular function
GO:0016887	ATPase activity	ISS	molecular function
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881