Search Result
Gene id | 1084 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | CEACAM3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | CD66D, CEA, CGM1, W264, W282 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | CEA cell adhesion molecule 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | carcinoembryonic antigen-related cell adhesion molecule 3, CD66d antigen, carcinoembryonic antigen CGM1, carcinoembryonic antigen gene family member 1, carcinoembryonic antigen related cell adhesion molecule 3, nonspecific cross-reacting antigen, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
19q13.2 (41796586: 41811553) Exons: 8 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several |
||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 611623 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | P40198 Name: Carcinoembryonic antigen related cell adhesion molecule 3 (Carcinoembryonic antigen CGM1) (CD antigen CD66d) Length: 252 Mass: 27091 Tissue specificity: CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, pro | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDG NSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPV GAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRT AASIYEELLKHDTNIYCRMDHKAEVAS | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: CEACAM3 Malacards: CEACAM3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
|