• Gene id: 1084

Gene Summary

• Gene Symbol: CEACAM3   Gene   UCSC   Ensembl
• Aliases: CD66D, CEA, CGM1, W264, W282
• Gene name: CEA cell adhesion molecule 3
• Alternate names: carcinoembryonic antigen-related cell adhesion molecule 3, CD66d antigen, carcinoembryonic antigen CGM1, carcinoembryonic antigen gene family member 1, carcinoembryonic antigen related cell adhesion molecule 3, nonspecific cross-reacting antigen,
• Gene location: 19q13.2 (41796586: 41811553)     Exons: 8     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several
• OMIM: 611623

Protein Summary

• Protein general information: P40198  
  • Name: Carcinoembryonic antigen related cell adhesion molecule 3 (Carcinoembryonic antigen CGM1) (CD antigen CD66d)
  • Length: 252  
  • Mass: 27091
  • Tissue specificity: CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, pro
• Sequence:

  MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDG
  NSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPV
  GAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRT
  AASIYEELLKHDTNIYCRMDHKAEVAS

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type")
  • Interpro: IPR036179  IPR013783  IPR013106  
  • PDB: 6AVZ 6AW0 6AW1 6AW3
  • PDBsum: 6AVZ 6AW0 6AW1 6AW3
  • STRING: ENSP00000349971
• Other Databases: GeneCards:  CEACAM3  Malacards:  CEACAM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881