Male Infertility Database

Search Result

Gene id

10818

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

FRS2 Gene UCSC Ensembl

Aliases

FRS1A, FRS2A, FRS2alpha, SNT, SNT-1, SNT1

Gene name

fibroblast growth factor receptor substrate 2

Alternate names

fibroblast growth factor receptor substrate 2, FGFR signalling adaptor, FGFR substrate 2, FGFR-signaling adaptor SNT, epididymis secretory sperm binding protein, suc1-associated neurotrophic factor target 1,

Gene location

12q15 (69470370: 69579792) Exons: 16 NC_000012.12

OMIM

607743

Protein Summary

Protein general information

Q8WU20

Name: Fibroblast growth factor receptor substrate 2 (FGFR substrate 2) (FGFR signaling adaptor SNT) (Suc1 associated neurotrophic factor target 1) (SNT 1)

Length: 508 Mass: 57029

Tissue specificity: Highly expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. {ECO

Sequence

MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFE
SGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGY
PRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAES
STPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWEARKLSRDEDDNLGPK
TPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP
QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPM

Structural information

Protein Domains	(13..11-) (/note="IRS-type-PTB) (/evidence="ECO:0000255\|PROSITE-ProRule:PRU00389"-)
Interpro:	IPR038742 IPR002404
Prosite:	PS51064
CDD:	cd01202
PDB:	1XR0 2MFQ
PDBsum:	1XR0 2MFQ
MINT:
STRING:	ENSP00000447241

Other Databases

GeneCards: FRS2 Malacards: FRS2

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005168	neurotrophin TRKA recepto r binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IGI	biological process
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0000186	activation of MAPKK activ ity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of pr otein kinase B signaling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070372	regulation of ERK1 and ER K2 cascade	IEA	biological process
GO:0070307	lens fiber cell developme nt	IEA	biological process
GO:0050678	regulation of epithelial cell proliferation	IEA	biological process
GO:0046619	optic placode formation i nvolved in camera-type ey e formation	IEA	biological process
GO:0007405	neuroblast proliferation	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005068	transmembrane receptor pr otein tyrosine kinase ada ptor activity	IEA	molecular function
GO:0002088	lens development in camer a-type eye	IEA	biological process
GO:0001702	gastrulation with mouth f orming second	IEA	biological process
GO:0000187	activation of MAPK activi ty	IEA	biological process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA	biological process
GO:0042981	regulation of apoptotic p rocess	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0008595	anterior/posterior axis s pecification, embryo	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	IEA	biological process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003281	ventricular septum develo pment	IEA	biological process
GO:0001759	organ induction	IEA	biological process
GO:2000726	negative regulation of ca rdiac muscle cell differe ntiation	IGI	biological process
GO:0005912	adherens junction	IDA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0019211	phosphatase activator act ivity	TAS	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0007186	G protein-coupled recepto r signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007185	transmembrane receptor pr otein tyrosine phosphatas e signaling pathway	TAS	biological process
GO:0005887	integral component of pla sma membrane	TAS	cellular component
GO:0005068	transmembrane receptor pr otein tyrosine kinase ada ptor activity	TAS	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04714	Thermogenesis
hsa05205	Proteoglycans in cancer
hsa04722	Neurotrophin signaling pathway

Diseases

Expand All | Collapse All

Associated diseases	References
renal cell carcinoma	PMID:25900027
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia			19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All