• Gene id: 10816

Gene Summary

• Gene Symbol: SPINT3   Gene   UCSC   Ensembl
• Aliases: HKIB9
• Gene name: serine peptidase inhibitor, Kunitz type 3
• Alternate names: kunitz-type protease inhibitor 3, serine protease inhibitor, Kunitz type, 3,
• Gene location: 20q13.12 (45515621: 45512460)     Exons: 2     NC_000020.11
• OMIM: 612517

Protein Summary

• Protein general information: P49223  
  • Name: Kunitz type protease inhibitor 3 (HKIB9)
  • Length: 89  
  • Mass: 10252
• Sequence:

  MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNN
  FLRKEKCEKFCKFT

• Structural information:
  • Protein Domains: (36..8-)
    (/note="BPTI/Kunitz-inhibitor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00031"-)
  • Interpro: IPR002223  IPR036880  IPR020901  
  • Prosite: PS00280 PS50279
  • CDD: cd00109
  • STRING: ENSP00000217428
• Other Databases: GeneCards:  SPINT3  Malacards:  SPINT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0048019	receptor antagonist activity	IBA	molecular function
GO:0050431	transforming growth factor beta binding	IBA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)