• Gene id: 10814

Gene Summary

• Gene Symbol: CPLX2   Gene   UCSC   Ensembl
• Aliases: 921-L, CPX-2, CPX2, Hfb1
• Gene name: complexin 2
• Alternate names: complexin-2, CPX II, complexin II, synaphin 1,
• Gene location: 5q35.2 (175796532: 175884020)     Exons: 8     NC_000005.10
• Gene summary(Entrez): Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and di

Protein Summary

• Protein general information: Q6PUV4  
  • Name: Complexin 2 (Complexin II) (CPX II) (Synaphin 1)
  • Length: 134  
  • Mass: 15394
  • Tissue specificity: Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum f
• Sequence:

  MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKK
  EEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

• Structural information:
  • Interpro: IPR008849  
  • STRING: ENSP00000352544
• Other Databases: GeneCards:  CPLX2  Malacards:  CPLX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017157	regulation of exocytosis	TAS	biological process
GO:0070554	synaptobrevin 2-SNAP-25-syntaxin-3-complexin complex	TAS	cellular component
GO:0016079	synaptic vesicle exocytosis	IBA	biological process
GO:0017075	syntaxin-1 binding	IBA	molecular function
GO:0031201	SNARE complex	IBA	cellular component
GO:0043195	terminal bouton	IBA	cellular component
GO:0046928	regulation of neurotransmitter secretion	IBA	biological process
GO:0000149	SNARE binding	IBA	molecular function
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0043303	mast cell degranulation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006904	vesicle docking involved in exocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0031915	positive regulation of synaptic plasticity	IEA	biological process
GO:0031630	regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0017075	syntaxin-1 binding	IEA	molecular function
GO:0016079	synaptic vesicle exocytosis	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0044305	calyx of Held	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0070033	synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex	IEA	cellular component
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0000149	SNARE binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0042629	mast cell granule	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04721	Synaptic vesicle cycle

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq