• Gene id: 10811

Gene Summary

• Gene Symbol: NOXA1   Gene   UCSC   Ensembl
• Aliases: NY-CO-31, SDCCAG31, p51NOX
• Gene name: NADPH oxidase activator 1
• Alternate names: NADPH oxidase activator 1, NCF2-like protein, Nox activator 1, antigen NY-CO-31, inhibitory NADPH oxidase activator 1, p51-nox, p67phox-like factor, serologically defined colon cancer antigen 31,
• Gene location: 9q34.3 (11965209: 11968067)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction be
• OMIM: 611255

Protein Summary

• Protein general information: Q86UR1  
  • Name: NADPH oxidase activator 1 (NOX activator 1) (Antigen NY CO 31) (NCF2 like protein) (P67phox like factor) (p51 nox)
  • Length: 476  
  • Mass: 50933
  • Tissue specificity: Widely expressed. Detected in pancreas, liver, kidney, spleen, prostate, small intestine and colon. {ECO
• Sequence:

  MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTCMAVGF
  FQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTEAASSLREAMS
  KWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQG
  PGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA
  GAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQLGQLSYLAPGEDGHWVPIPEEESLQ
  RAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGFRQGDTVDVLCEVDQAWLEGHCDGRIGIFPK
  CFVVPAGPRMSGAPGRLPRSQQGDQP

• Structural information:
  • Protein Domains: (315..39-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (399..45-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR034899  IPR000270  IPR036028  IPR001452  IPR013026   IPR011990  IPR019734  
  • Prosite: PS51745 PS50002 PS50293
  • STRING: ENSP00000342848
• Other Databases: GeneCards:  NOXA1  Malacards:  NOXA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0042554	superoxide anion generation	IBA	biological process
GO:0016176	superoxide-generating NADPH oxidase activator activity	IBA	molecular function
GO:0048365	Rac GTPase binding	IBA	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006801	superoxide metabolic process	IEA	biological process
GO:0043020	NADPH oxidase complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006801	superoxide metabolic process	IEA	biological process
GO:0016176	superoxide-generating NADPH oxidase activator activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016176	superoxide-generating NADPH oxidase activator activity	IMP	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0048365	Rac GTPase binding	IPI	molecular function
GO:0043020	NADPH oxidase complex	IDA	cellular component
GO:0010310	regulation of hydrogen peroxide metabolic process	IMP	biological process
GO:0060263	regulation of respiratory burst	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0016176	superoxide-generating NADPH oxidase activator activity	IDA	molecular function
GO:0006801	superoxide metabolic process	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq