• Gene id: 1081

Gene Summary

• Gene Symbol: CGA   Gene   UCSC   Ensembl
• Aliases: CG-ALPHA, FSHA, GPHA1, GPHa, HCG, LHA, TSHA
• Gene name: glycoprotein hormones, alpha polypeptide
• Alternate names: glycoprotein hormones alpha chain, FSH-alpha, LSH-alpha, TSH-alpha, anterior pituitary glycoprotein hormones common subunit alpha, choriogonadotropin alpha chain, chorionic gonadotrophin subunit alpha, chorionic gonadotropin, alpha polypeptide, follicle-s,
• Gene location: 6q14.3 (87095146: 87085497)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The a
• OMIM: 118850

SNPs

rs6631

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.87085541A>C
NC_000006.12   g.87085541A>T
NC_000006.11   g.87795259A>C
NC_000006.11   g.87795259A>T
NM_000735.3   c.*215T>G
NM_000735.3   c.*215T>A
NM_000735.4   c.*215T>G
NM_000735.4   c.*215T>A
NM_001252383.1   c.*215T>G
NM_001252383.1   c.*215T>A
NM_0  

Protein Summary

• Protein general information: P01215  
  • Name: Glycoprotein hormones alpha chain (Anterior pituitary glycoprotein hormones common subunit alpha) (Choriogonadotropin alpha chain) (Chorionic gonadotrophin subunit alpha) (CG alpha) (Follicle stimulating hormone alpha chain) (FSH alpha) (Follitropin alpha
  • Length: 116  
  • Mass: 13,075
• Sequence:

  MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQK
  NVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

• Structural information:
  • Interpro: IPR029034  IPR000476  
  • Prosite: PS00779 PS00780 PS50277
  • PDB: 1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD 4AY9 4MQW
  • PDBsum: 1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD 4AY9 4MQW
  • DIP: 6182
  • STRING: ENSP00000358595
• Other Databases: GeneCards:  CGA  Malacards:  CGA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005179	hormone activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	NAS	biological process
GO:0016486	peptide hormone processing	TAS	biological process
GO:0030335	positive regulation of cell migration	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	NAS	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IMP	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	NAS	biological process
GO:0016486	peptide hormone processing	TAS	biological process
GO:0030335	positive regulation of cell migration	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	NAS	biological process
GO:0005179	hormone activity	IMP	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell proliferation	NAS	biological process
GO:0016486	peptide hormone processing	TAS	biological process
GO:0030335	positive regulation of cell migration	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa00140	Steroid hormone biosynthesis
hsa00564	Glycerophospholipid metabolism
hsa00982	Drug metabolism - cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00983	Drug metabolism - other enzymes
hsa03022	Basal transcription factors
hsa03040	Spliceosome
hsa03013	RNA transport
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa04080	Neuroactive ligand-receptor interaction
hsa04923	Regulation of lipolysis in adipocytes
hsa04929	GnRH secretion
hsa04912	GnRH signaling pathway
hsa04913	Ovarian steroidogenesis
hsa04917	Prolactin signaling pathway
hsa04918	Thyroid hormone synthesis
hsa05320	Autoimmune thyroid disease

Diseases

Associated diseases	References
Cancer (bladder)	GAD: 19692168
Cancer (lung)	GAD: 18676680
Cancer (prostate)	GAD: 19574343
Cancer (thyroid)	GAD: 19730683
Cancer	GAD: 19692168
Cancer (breast)	GAD: 20634197
Obesity	GAD: 20734064
Autism	GAD: 19598235
Secondary hyperprolactinaemia	INFBASE: 8183759
Female infertility	INFBASE: 25488203
Oligomenorrhea	INFBASE: 8183759
Extrauterine pregnancy	INFBASE: 7052392
Premature ovarian failure (POF)	INFBASE: 8629455
Unexplained infertility	INFBASE: 3356777
Male factor infertility	MIK: 6601587
Semen quality	MIK: 21838882
Spermatogenesis defects	MIK: 21601192
Spermatogenesis defects	MIK: 21838882
Male factor infertility	MIK: 29627965
Adenomyosis	INFBASE: 7680356
Ectopic endometrial implants	INFBASE: 1400884
Ectopic pregnancy	INFBASE: 6965436
Female infertility	INFBASE: 3356777
Implantation failure	INFBASE: 18249366
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Male infertility	MIK: 6601587
Semen quality	MIK: 21838882
Spermatogenetic defects	MIK: 21838882

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21838882	Spermatogenetic defects			45 ( 29 Abnormal semen analysis, 16 normozoospermic men )	Male infertility
21838882	Semen quality, Male infertility			45 (29 patients with abnormal semen, 16 normozoopsermic)	Male infertility
6601587	Male infertility			62 (20 normal men and 42 patients with infertility)	Male infertility