• Gene id: 10808

Gene Summary

• Gene Symbol: HSPH1   Gene   UCSC   Ensembl
• Aliases: HSP105, HSP105A, HSP105B, NY-CO-25
• Gene name: heat shock protein family H (Hsp110) member 1
• Alternate names: heat shock protein 105 kDa, antigen NY-CO-25, heat shock 105kDa/110kDa protein 1,
• Gene location: 13q12.3 (31162387: 31134972)     Exons: 20     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the heat shock protein 70 family of proteins. The encoded protein functions as a nucleotide exchange factor for the molecular chaperone heat shock cognate 71 kDa protein (Hsc70). In addition, this protein plays a distinct but
• OMIM: 610703

Protein Summary

• Protein general information: Q92598  
  • Name: Heat shock protein 105 kDa (Antigen NY CO 25) (Heat shock 110 kDa protein)
  • Length: 858  
  • Mass: 96865
  • Tissue specificity: Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells. {ECO
• Sequence:

  MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRFHGRAF
  NDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISVPSFFTD
  AERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGT
  AFDPFLGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
  MNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGKDISTTLNADEAVARG
  CALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQ
  GVPYPEAKIGRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENP
  DTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEA
  NLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDW
  LYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKK
  VEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKE
  EDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD

• Structural information:
  • Interpro: IPR018181  IPR029048  IPR029047  IPR013126  IPR042053  
  • Prosite: PS01036
  • CDD: cd11739
  • PDB: 6GFA
  • PDBsum: 6GFA
  • STRING: ENSP00000318687
• Other Databases: GeneCards:  HSPH1  Malacards:  HSPH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000774	adenyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006986	response to unfolded protein	TAS	biological process
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0071682	endocytic vesicle lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IEA	biological process
GO:0043014	alpha-tubulin binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0045345	positive regulation of MHC class I biosynthetic process	TAS	biological process
GO:0051135	positive regulation of NK T cell activation	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)