• Gene id: 10807

Gene Summary

• Gene Symbol: ENTR1   Gene   UCSC   Ensembl
• Aliases: NY-CO-3, SDCCAG3, SDDAG3
• Gene name: endosome associated trafficking regulator 1
• Alternate names: endosome-associated-trafficking regulator 1, antigen NY-CO-3, serologically defined colon cancer antigen 3,
• Gene location: 9q34.3 (136410613: 136401921)     Exons: 10     NC_000009.12
• OMIM: 618289

Protein Summary

• Protein general information: Q96C92  
  • Name: Endosome associated trafficking regulator 1 (Antigen NY CO 3) (Serologically defined colon cancer antigen 3)
  • Length: 435  
  • Mass: 47961
  • Tissue specificity: Expressed in the colon (at protein level). {ECO
• Sequence:

  MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMCYVPSPVLASVGDTDF
  GYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNLGLSKEDPASRIYAKEASRHSLGLDHNSPPS
  QTGGYGLEYQQPFFEDPTGAGDLLDEEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPE
  SLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVR
  TLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGA
  SLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEEDS

• Structural information:
  • Interpro: IPR026757  
  • STRING: ENSP00000349929
• Other Databases: GeneCards:  ENTR1  Malacards:  ENTR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	cellular component
GO:0036064	ciliary basal body	IBA	cellular component
GO:0045724	positive regulation of cilium assembly	IBA	biological process
GO:0055037	recycling endosome	IBA	cellular component
GO:1990126	retrograde transport, endosome to plasma membrane	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0030496	midbody	IBA	cellular component
GO:0030904	retromer complex	IBA	colocalizes with
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:1903566	positive regulation of protein localization to cilium	IBA	biological process
GO:0005768	endosome	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0030904	retromer complex	IDA	colocalizes with
GO:0030496	midbody	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0032465	regulation of cytokinesis	IDA	biological process
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0045724	positive regulation of cilium assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903566	positive regulation of protein localization to cilium	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0030496	midbody	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray