• Gene id: 10800

Gene Summary

• Gene Symbol: CYSLTR1   Gene   UCSC   Ensembl
• Aliases: CYSLT1, CYSLT1R, CYSLTR, HMTMF81
• Gene name: cysteinyl leukotriene receptor 1
• Alternate names: cysteinyl leukotriene receptor 1, G-protein coupled receptor HG55, LTD4 receptor, cysteinyl leukotriene D4 receptor,
• Gene location: Xq21.1 (78327690: 78271467)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system.
• OMIM: 300201

Protein Summary

• Protein general information: Q9Y271  
  • Name: Cysteinyl leukotriene receptor 1 (CysLTR1) (Cysteinyl leukotriene D4 receptor) (LTD4 receptor) (G protein coupled receptor HG55) (HMTMF81)
  • Length: 337  
  • Mass: 38541
  • Tissue specificity: Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon a
• Sequence:

  MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCT
  LPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIF
  VILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNL
  SSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
  NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

• Structural information:
  • Interpro: IPR013310  IPR004071  IPR000276  IPR017452  
  • Prosite: PS50262
  • PDB: 6RZ4 6RZ5
  • PDBsum: 6RZ4 6RZ5
  • STRING: ENSP00000478492
• Other Databases: GeneCards:  CYSLTR1  Malacards:  CYSLTR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004966	galanin receptor activity	IBA	molecular function
GO:0004974	leukotriene receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004974	leukotriene receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007585	respiratory gaseous exchange by respiratory system	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002437	inflammatory response to antigenic stimulus	IEA	biological process
GO:0004974	leukotriene receptor activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Sleep apnea	PMID:18490405
Asthma	PMID:16123393
Asthma	PMID:17153879
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881