About Us

Search Result


Gene id 10793
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF273   Gene   UCSC   Ensembl
Aliases HZF9
Gene name zinc finger protein 273
Alternate names zinc finger protein 273, zinc finger protein 9, zinc finger protein HZF9,
Gene location 7q11.21 (64882492: 64932238)     Exons: 10     NC_000007.14
Gene summary(Entrez) This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with 13 C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in transcriptional regulation. Alternative splicing results in multiple tra
OMIM 604756

Protein Summary

Protein general information Q14593  

Name: Zinc finger protein 273 (Zinc finger protein HZF9)

Length: 569  Mass: 64971

Sequence MSSAPRGPPSVAPLPAGIGRSTAKTPGLPGSLEMGPLTFRDVAIEFSLEEWQCLDTSQQNLYRNVMLDNYRNLVF
LGIAVSKPDLITCLEQGKEPCNMKRHAMVAKPPVVCSHFAQDLWPKQGLKDSFQKVILRRYGKYGHENLQLRKGC
KSADEHKVHKRGYNGLNQCLTTTQSKIFQCDKYVKVLHKFSNSNIHKKRQTGKKPFKCKECGKSCCILSQLTQHK
KTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVNPYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCEDCGKVFS
VFSVLTKHKIIHTGTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYK
CEECGKAFNQSSTLTRHKIVHTGEKPYKCEECGKAFKRSTTLTKHKRIYTKEKPYKCEECGKAFSVFSTLTKHKI
IHTGAKPYKCEECGSAFRAFSTLTEHKRVHTGEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNR
SSNLTRHKKIHTGEKPYKPKRCDSAFDNTPNFSRHKRNHMGEKS
Structural information
Protein Domains
(66..10-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR036236  IPR013087  
Prosite:   PS50805 PS00028 PS50157
CDD:   cd07765
STRING:   ENSP00000418719
Other Databases GeneCards:  ZNF273  Malacards:  ZNF273

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
IBA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IBA biological process
GO:0005634 nucleus
IBA cellular component
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract