Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 10791
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol VAMP5   Gene   UCSC   Ensembl
Gene name vesicle associated membrane protein 5
Alternate names vesicle-associated membrane protein 5, VAMP-5, myobrevin,
Gene location 2p11.2 (85584430: 85593405)     Exons: 3     NC_000002.12
Gene summary(Entrez) Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane
OMIM 602377

Protein Summary
Protein general information O95183  

Name: Vesicle associated membrane protein 5 (VAMP 5) (Myobrevin)

Length: 116  Mass: 12805

Sequence MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGL
VVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Structural information
Protein Domains
 (5..6-)
homology (/note="v-SNARE-coiled-coil)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00290"-)
Interpro:  IPR001388  IPR016444  IPR042855  IPR042166  IPR042581  
Prosite:   PS00417 PS50892
CDD:   cd15872
MINT:  
STRING:   ENSP00000305647
Other Databases GeneCards:  VAMP5  Malacards:  VAMP5

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0043001 Golgi to plasma membrane
protein transport
 IBA biological process
GO:0005886 plasma membrane
 IBA cellular component
GO:0016192 vesicle-mediated transpor
t
 IEA biological process
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0030154 cell differentiation
 IEA biological process
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0007517 muscle organ development
 IEA biological process
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0007517 muscle organ development
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0030659 cytoplasmic vesicle membr
ane
 IEA cellular component
GO:0014704 intercalated disc
 IEA cellular component
GO:0043001 Golgi to plasma membrane
protein transport
 IEA biological process
GO:0031301 integral component of org
anelle membrane
 IEA cellular component
GO:0007519 skeletal muscle tissue de
velopment
 IEA biological process
GO:0005887 integral component of pla
sma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005770 late endosome
 IEA cellular component
GO:0009986 cell surface
 IDA cellular component
GO:0014704 intercalated disc
 ISS cellular component
GO:0048471 perinuclear region of cyt
oplasm
 ISS cellular component
GO:0030659 cytoplasmic vesicle membr
ane
 ISS cellular component
GO:0005770 late endosome
 ISS cellular component
GO:0031301 integral component of org
anelle membrane
 ISS cellular component
GO:0012505 endomembrane system
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0070062 extracellular exosome
 HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04130SNARE interactions in vesicular transport

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract