• Gene id: 10787

Gene Summary

• Gene Symbol: NCKAP1   Gene   UCSC   Ensembl
• Aliases: HEM2, NAP1, NAP125, p125Nap1
• Gene name: NCK associated protein 1
• Alternate names: nck-associated protein 1, membrane-associated protein HEM-2,
• Gene location: 2q32.1 (183038456: 182909114)     Exons: 32     NC_000002.12
• OMIM: 604891

Protein Summary

• Protein general information: Q9Y2A7  
  • Name: Nck associated protein 1 (NAP 1) (Membrane associated protein HEM 2) (p125Nap1)
  • Length: 1128  
  • Mass: 128790
  • Tissue specificity: Expressed in all tissues examined except peripheral blood leukocytes, with highest expression in brain, heart, and skeletal muscle.
• Sequence:

  MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQ
  LAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRI
  EERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWR
  NAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEV
  FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMAL
  SFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLS
  VCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKM
  VDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
  MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNL
  DKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVL
  QSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTF
  NAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
  DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPAL
  VVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGS
  IEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVT
  SSA

• Structural information:
  • Interpro: IPR019137  
  • PDB: 3P8C 4N78
  • PDBsum: 3P8C 4N78
  • DIP: 31119
  • STRING: ENSP00000354251
• Other Databases: GeneCards:  NCKAP1  Malacards:  NCKAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000902	cell morphogenesis	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0030866	cortical actin cytoskeleton organization	IBA	biological process
GO:0031209	SCAR complex	IBA	cellular component
GO:0048365	Rac GTPase binding	IBA	contributes to
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001726	ruffle	ISS	cellular component
GO:0010592	positive regulation of lamellipodium assembly	ISS	biological process
GO:0030838	positive regulation of actin filament polymerization	ISS	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0031941	filamentous actin	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:2000601	positive regulation of Arp2/3 complex-mediated actin nucleation	IDA	biological process
GO:0016601	Rac protein signal transduction	IDA	biological process
GO:0048365	Rac GTPase binding	IDA	contributes to
GO:0031209	SCAR complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0010592	positive regulation of lamellipodium assembly	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)