• Gene id: 10786

Gene Summary

• Gene Symbol: SLC17A3   Gene   UCSC   Ensembl
• Aliases: GOUT4, NPT4, UAQTL4
• Gene name: solute carrier family 17 member 3
• Alternate names: sodium-dependent phosphate transport protein 4, Na(+)/PI cotransporter 4, sodium/phosphate cotransporter 4, solute carrier family 17 (organic anion transporter), member 3, solute carrier family 17 (sodium phosphate), member 3,
• Gene location: 6p22.2 (25874242: 25844855)     Exons: 13     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a voltage-driven transporter that excretes intracellular urate and organic anions from the blood into renal tubule cells. Two transcript variants encoding different isoforms have been found for this gene. The longer iso
• OMIM: 611034

Protein Summary

• Protein general information: O00476  
  • Name: Sodium dependent phosphate transport protein 4 (Na(+)/PI cotransporter 4) (Sodium/phosphate cotransporter 4) (Solute carrier family 17 member 3)
  • Length: 420  
  • Mass: 46106
  • Tissue specificity: Expressed in the liver and kidney. It is detected in proximal tubules in renal cortex as well as some tubules and glomeruli, with highest expression at the apical side of proximal tubules (at protein level). {ECO
• Sequence:

  MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMNITMVAMVNSTSPQSQ
  LNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQERSRLCSIALSGMLLGCFTAILIGGFISETL
  GWPFVFYIFGGVGCVCCLLWFVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWSICLGC
  FSHQWLVSTMVVYIPTYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLLTKKFRLITVRKIATILGSLP
  SSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSFLMGASRGFSSIAPVIVPTVSGFLLS
  QDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR017373  
  • Prosite: PS50850
  • STRING: ENSP00000380250
• Other Databases: GeneCards:  SLC17A3  Malacards:  SLC17A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008308	voltage-gated anion channel activity	IBA	molecular function
GO:0015562	efflux transmembrane transporter activity	IBA	molecular function
GO:0015747	urate transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0019534	toxin transmembrane transporter activity	IBA	molecular function
GO:0006820	anion transport	IBA	biological process
GO:0008514	organic anion transmembrane transporter activity	IBA	molecular function
GO:0015143	urate transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005436	sodium:phosphate symporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0015143	urate transmembrane transporter activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:1901998	toxin transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane	IDA	biological process
GO:0015747	urate transport	IDA	biological process
GO:0015711	organic anion transport	IDA	biological process
GO:0015562	efflux transmembrane transporter activity	IDA	molecular function
GO:0008308	voltage-gated anion channel activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0019534	toxin transmembrane transporter activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0015143	urate transmembrane transporter activity	IDA	molecular function
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:0046415	urate metabolic process	IMP	biological process
GO:0046415	urate metabolic process	IMP	biological process
GO:0005436	sodium:phosphate symporter activity	ISS	molecular function
GO:0015760	glucose-6-phosphate transport	TAS	biological process
GO:0006817	phosphate ion transport	ISS	biological process
GO:0006814	sodium ion transport	ISS	biological process
GO:0046415	urate metabolic process	IMP	biological process
GO:0031526	brush border membrane	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)